Dynein heavy chain (DNAH9) Rabbit Polyclonal Antibody TA338182 from OriGene Technologies | Biocompare.com

Supplier Images

Dynein heavy chain (DNAH9) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Dynein heavy chain (DNAH9) Rabbit Polyclonal Antibody

The Dynein heavy chain (DNAH9) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Mouse antigen. The Dynein heavy chain (DNAH9) Rabbit Polyclonal Antibody has been validated for the following applications: Immunocytochemistry, Immunofluorescence, and Western Blot.

Description

Rabbit Polyclonal Anti-DNAH9 Antibody

Product Specs
ItemDynein heavy chain (DNAH9) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA338182
Quantity100 µl
ApplicationsIF, WB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityMouse
TargetDNAH9
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-DNAH9 antibody is: synthetic peptide directed towards the C-terminal region of Human DNAH9. Synthetic peptide located within the following region: DSQARDGAGATREEKVKALLEEILERVTDEFNIPELMAKVEERTPYIVVA
NCBI Full Gene Namedynein axonemal heavy chain 9
NCBI Gene AliasesDnahc9, DNAH17L, CILD40, HL-20, DYH9, DNEL1, HL20
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!